Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (13 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [255903] (1 PDB entry) |
Domain d3k2va_: 3k2v A: [247102] automated match to d4o9kb_ complexed with cmk, gol, so4 |
PDB Entry: 3k2v (more details), 1.95 Å
SCOPe Domain Sequences for d3k2va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2va_ d.37.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]} galgrklllrvndimhtgdeiphvglqatlrdalleitrknlgmtaicdddmniigiftd gdlrrvfdtgvdmrdasiadvmtrggirirpgtlavdalnlmqsrhitcvlvadgdhllg vvhmhdllra
Timeline for d3k2va_: