SCOPe 2.05: Domain d3k2hb1: 3k2h B:4-187

Lineage for d3k2hb1 (3k2h B:4-187)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries)

8. Domain d3k2hb1: 3k2h B:4-187 [247100]
   Other proteins in same PDB: d3k2ha2, d3k2hb2
   automated match to d3i3ra1
   complexed with edo, lya, nap, ump

Details for d3k2hb1

PDB Entry: 3k2h, 2.2 Å

PDB Description: co-crystal structure of dihydrofolate reductase/thymidylate synthase from babesia bovis with dump, pemetrexed and nadp

PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3k2hb1:

Sequence; same for both SEQRES and ATOM records:

>d3k2hb1 c.71.1.0 (B:4-187) automated matches {Babesia bovis [TaxId: 484906]}
syegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvv
ifgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifil
ggsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfvi
yerk

Timeline for d3k2hb1:

• d3k2hb1 first appeared in SCOPe 2.04
  
• d3k2hb1 appears in SCOPe 2.06
  
• d3k2hb1 appears in the current release, SCOPe 2.08