![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries) |
![]() | Domain d3k2ha1: 3k2h A:4-187 [247098] Other proteins in same PDB: d3k2ha2, d3k2hb2 automated match to d3i3ra1 complexed with edo, lya, nap, ump |
PDB Entry: 3k2h (more details), 2.2 Å
SCOPe Domain Sequences for d3k2ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2ha1 c.71.1.0 (A:4-187) automated matches {Babesia bovis [TaxId: 484906]} syegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvv ifgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifil ggsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfvi yerk
Timeline for d3k2ha1: