![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries) |
![]() | Domain d3k0jd_: 3k0j D: [247091] automated match to d1dz5a_ protein/RNA complex; complexed with mg, tpp |
PDB Entry: 3k0j (more details), 3.1 Å
SCOPe Domain Sequences for d3k0jd_:
Sequence, based on SEQRES records: (download)
>d3k0jd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa tnalrsmqgfpfydkpmriqyakt
>d3k0jd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrsmrgqafvifkevssatn alrsmqgfpfydkpmriqyakt
Timeline for d3k0jd_: