Lineage for d3k0jd_ (3k0j D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952408Domain d3k0jd_: 3k0j D: [247091]
    automated match to d1dz5a_
    protein/RNA complex; complexed with mg, tpp

Details for d3k0jd_

PDB Entry: 3k0j (more details), 3.1 Å

PDB Description: crystal structure of the e. coli thim riboswitch in complex with thiamine pyrophosphate and the u1a crystallization module
PDB Compounds: (D:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d3k0jd_:

Sequence, based on SEQRES records: (download)

>d3k0jd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyakt

Sequence, based on observed residues (ATOM records): (download)

>d3k0jd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrsmrgqafvifkevssatn
alrsmqgfpfydkpmriqyakt

SCOPe Domain Coordinates for d3k0jd_:

Click to download the PDB-style file with coordinates for d3k0jd_.
(The format of our PDB-style files is described here.)

Timeline for d3k0jd_: