SCOPe 2.03: Domain d1ht0a1: 1ht0 A:1-162,A:339-374

Lineage for d1ht0a1 (1ht0 A:1-162,A:339-374)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1ht0a1: 1ht0 A:1-162,A:339-374 [24709]
   Other proteins in same PDB: d1ht0a2, d1ht0b2
   gamma-2 isozyme
   complexed with nad, zn

Details for d1ht0a1

PDB Entry: 1ht0, 2 Å

PDB Description: human gamma-2 alcohol dehydrogense

PDB Compounds: (A:) class I alcohol dehydrogenase 3, gamma subunit

SCOPe Domain Sequences for d1ht0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ht0a1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaXkfsldalitnvlpfeki
negfdllrsgksirtvltf

Timeline for d1ht0a1:

• d1ht0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ht0a1 appears in SCOPe 2.02
  
• d1ht0a1 appears in SCOPe 2.04
  
• d1ht0a1 appears in the current release, SCOPe 2.08