Lineage for d1ht0a1 (1ht0 A:1-162,A:339-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785641Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2785664Domain d1ht0a1: 1ht0 A:1-162,A:339-374 [24709]
    Other proteins in same PDB: d1ht0a2, d1ht0b2
    gamma-2 isozyme
    complexed with nad, zn

Details for d1ht0a1

PDB Entry: 1ht0 (more details), 2 Å

PDB Description: human gamma-2 alcohol dehydrogense
PDB Compounds: (A:) class I alcohol dehydrogenase 3, gamma subunit

SCOPe Domain Sequences for d1ht0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht0a1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaXkfsldalitnvlpfeki
negfdllrsgksirtvltf

SCOPe Domain Coordinates for d1ht0a1:

Click to download the PDB-style file with coordinates for d1ht0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ht0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ht0a2