Lineage for d3k02a_ (3k02 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626620Species Streptomyces glaucescens [TaxId:1907] [255902] (3 PDB entries)
  8. 1626623Domain d3k02a_: 3k02 A: [247087]
    automated match to d2ghab_
    complexed with so4, txt

Details for d3k02a_

PDB Entry: 3k02 (more details), 1.55 Å

PDB Description: crystal structures of the gach receptor of streptomyces glaucescens gla.o in the unliganded form and in complex with acarbose and an acarbose homolog. comparison with acarbose-loaded maltose binding protein of salmonella typhimurium.
PDB Compounds: (A:) Acarbose/maltose binding protein GacH

SCOPe Domain Sequences for d3k02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k02a_ c.94.1.0 (A:) automated matches {Streptomyces glaucescens [TaxId: 1907]}
elsgtvtfwdtsneaekatyqalaegfekehpkvdvkyvnvpfgeanakfknaaggnsga
pdvmrtevawvadfasigylapldgtpalddgsdhlpqaaastryegktyavpqvidtla
lfynkelltkagvevpgsvaelktaaaeitektgatglylrgddpywflpylygeggdlv
deknktvtvddeagvrayrvikdlvdskaaitdasdgwnnmqnafksgkvammvngpwai
edvkagarfkdagnlgvapvpagsagqgspqggwnlsvyagsknldasyafvkymssakv
qqqtteklsllptrtsvyevpsvadnemvkffkpavdkaverpwiaegnalfepirlqma
nvlsgetspdeaaantgdayrkllkdyk

SCOPe Domain Coordinates for d3k02a_:

Click to download the PDB-style file with coordinates for d3k02a_.
(The format of our PDB-style files is described here.)

Timeline for d3k02a_: