Lineage for d7adh_1 (7adh 1-174,326-374)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13364Protein Alcohol dehydrogenase [50137] (4 species)
  7. 13368Species Horse (Equus caballus) [TaxId:9796] [50138] (22 PDB entries)
  8. 13414Domain d7adh_1: 7adh 1-174,326-374 [24708]
    Other proteins in same PDB: d7adh_2

Details for d7adh_1

PDB Entry: 7adh (more details), 3.2 Å

PDB Description: three-dimensional structure of isonicotinimidylated liver alcohol dehydrogenase
PDB Compounds: ( :)

SCOP Domain Sequences for d7adh_1:

Sequence, based on SEQRES records: (download)

>d7adh_1 b.35.1.2 (1-174,326-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagxvixcxaavlweexxpfsieevevappxahevrixmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdxviplftpqcgxcrvckhpegnfclxndlsmpr
gtmqdgtsrftcrgxpihhflgtstfsqytvvdeisvaxidaasplexvcligcXdsvpx
lvadfmakkfaldplithvlpfexinegfdllrsgesirtiltf

Sequence, based on observed residues (ATOM records): (download)

>d7adh_1 b.35.1.2 (1-174,326-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagvicaavlweepfsieevevappahevrimvatgicrsddhvvsgtlvtplpviagh
eaagivesigegvttvrpgdviplftpqcgcrvckhpegnfclndlsmprgtmqdgtsrf
tcrgpihhflgtstfsqytvvdeisvaidaasplevcligcXdsvplvadfmakkfaldp
lithvlpfeinegfdllrsgesirtiltf

SCOP Domain Coordinates for d7adh_1:

Click to download the PDB-style file with coordinates for d7adh_1.
(The format of our PDB-style files is described here.)

Timeline for d7adh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7adh_2