SCOPe 2.06: Domain d3jzfb1: 3jzf B:1-114

Lineage for d3jzfb1 (3jzf B:1-114)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)

8. Domain d3jzfb1: 3jzf B:1-114 [247076]
   Other proteins in same PDB: d3jzfa2, d3jzfb2, d3jzfb3, d3jzfb4
   automated match to d1dv2a2
   complexed with co3, jzk

Details for d3jzfb1

PDB Entry: 3jzf, 2.13 Å

PDB Description: Crystal structure of biotin carboxylase from E. Coli in complex with benzimidazoles series

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3jzfb1:

Sequence; same for both SEQRES and ATOM records:

>d3jzfb1 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d3jzfb1:

• d3jzfb1 first appeared in SCOPe 2.04
  
• d3jzfb1 appears in SCOPe 2.05
  
• d3jzfb1 appears in SCOPe 2.07
  
• d3jzfb1 appears in the current release, SCOPe 2.08