Lineage for d3jzfa2 (3jzf A:331-449)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809036Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 1809043Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1809046Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 1809070Domain d3jzfa2: 3jzf A:331-449 [247075]
    Other proteins in same PDB: d3jzfa1, d3jzfb1, d3jzfb2
    automated match to d2w6za3
    complexed with co3, jzk

Details for d3jzfa2

PDB Entry: 3jzf (more details), 2.13 Å

PDB Description: Crystal structure of biotin carboxylase from E. Coli in complex with benzimidazoles series
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3jzfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jzfa2 b.84.2.1 (A:331-449) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqek

SCOPe Domain Coordinates for d3jzfa2:

Click to download the PDB-style file with coordinates for d3jzfa2.
(The format of our PDB-style files is described here.)

Timeline for d3jzfa2: