SCOPe 2.08: Domain d3jz6b_: 3jz6 B:

Lineage for d3jz6b_ (3jz6 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.0: automated matches [191499] (1 protein)
   not a true family

6. Protein automated matches [190815] (21 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [232037] (3 PDB entries)

8. Domain d3jz6b_: 3jz6 B: [247073]
   automated match to d3dtga_
   complexed with gol, plp

Details for d3jz6b_

PDB Entry: 3jz6, 1.9 Å

PDB Description: crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom.

PDB Compounds: (B:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d3jz6b_:

Sequence; same for both SEQRES and ATOM records:

>d3jz6b_ e.17.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
rln

Timeline for d3jz6b_:

• d3jz6b_ first appeared in SCOPe 2.04
  
• d3jz6b_ appears in SCOPe 2.07