Lineage for d3jxeb_ (3jxe B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106185Species Pyrococcus horikoshii [TaxId:53953] [255901] (1 PDB entry)
  8. 2106187Domain d3jxeb_: 3jxe B: [247071]
    automated match to d1ulhb_
    protein/RNA complex; complexed with so4, tym

Details for d3jxeb_

PDB Entry: 3jxe (more details), 3 Å

PDB Description: Crystal structure of Pyrococcus horikoshii tryptophanyl-tRNA synthetase in complex with TrpAMP
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3jxeb_:

Sequence, based on SEQRES records: (download)

>d3jxeb_ c.26.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mveefkvtpwevegvvdydklikhfgtspltedllektaeltkselpiffrrkfffshrd
ydlilkdyeegrgfflytgrgpsgpmhighiipffatkwlqekfgvnlyiqitddekflf
kenltfddtkrwaydnildiiavgfdpdktfifqnseftkiyemaipiakkinfsmakav
fgfteqskigmiffpaiqiaptfferkrclipaaidqdpywrlqrdfaeslgyyktaalh
skfvpsltslsgkmsaskpetaiyltdspedvekkvwkftltggrptlkeqrekggepek
cvvfkwleiffeeddkklkeryyackngeltcgeckryliskiqeflkehqrrrkkaekl
vekfkytgklaqemwneaipe

Sequence, based on observed residues (ATOM records): (download)

>d3jxeb_ c.26.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mveefkvtpwevegvvdydklikhfgtspltedllektaeltkselpiffrrkfffshrd
ydlilkdyeegrgfflytgrgpsgpmhighiipffatkwlqekfgvnlyiqitddekflf
kenltfddtkrwaydnildiiavgfdpdktfifqnseftkiyemaipiakkinfsmakav
fgfteqskigmiffpaiqiaptfferkrclipaaidqdpywrlqrdfaeslgyyktaalh
skfvpsltslsgkmsaskpetaiyltdspedvekkvwkftlkcvvfkwleiffeeddkkl
keryyackngeltcgeckryliskiqeflkehqrrrkkaeklvekfkytgklaqemwnea
ipe

SCOPe Domain Coordinates for d3jxeb_:

Click to download the PDB-style file with coordinates for d3jxeb_.
(The format of our PDB-style files is described here.)

Timeline for d3jxeb_: