Lineage for d6adhb1 (6adh B:1-174,B:325-374)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58601Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 58602Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 58652Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 58653Protein Alcohol dehydrogenase [50137] (4 species)
  7. 58657Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)
  8. 58710Domain d6adhb1: 6adh B:1-174,B:325-374 [24707]
    Other proteins in same PDB: d6adha2, d6adhb2

Details for d6adhb1

PDB Entry: 6adh (more details), 2.9 Å

PDB Description: structure of triclinic ternary complex of horse liver alcohol dehydrogenase at 2.9 angstroms resolution

SCOP Domain Sequences for d6adhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adhb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d6adhb1:

Click to download the PDB-style file with coordinates for d6adhb1.
(The format of our PDB-style files is described here.)

Timeline for d6adhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6adhb2