Lineage for d6adhb1 (6adh B:1-163,B:340-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785523Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
    Uniprot P00327
  8. 2785639Domain d6adhb1: 6adh B:1-163,B:340-374 [24707]
    Other proteins in same PDB: d6adha2, d6adhb2
    complexed with dms, nad, zn

Details for d6adhb1

PDB Entry: 6adh (more details), 2.9 Å

PDB Description: structure of triclinic ternary complex of horse liver alcohol dehydrogenase at 2.9 angstroms resolution
PDB Compounds: (B:) holo-liver alcohol dehydrogenase

SCOPe Domain Sequences for d6adhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adhb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d6adhb1:

Click to download the PDB-style file with coordinates for d6adhb1.
(The format of our PDB-style files is described here.)

Timeline for d6adhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6adhb2