SCOPe 2.05: Domain d3jw0c_: 3jw0 C:

Lineage for d3jw0c_ (3jw0 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
   consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation

4. Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families)
   automatically mapped to Pfam PF00632

5. Family d.148.1.0: automated matches [227207] (1 protein)
   not a true family

6. Protein automated matches [226939] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225255] (10 PDB entries)

8. Domain d3jw0c_: 3jw0 C: [247066]
   Other proteins in same PDB: d3jw0a_, d3jw0b_, d3jw0x_, d3jw0y_
   automated match to d4bbna_

Details for d3jw0c_

PDB Entry: 3jw0, 3.1 Å

PDB Description: e2~ubiquitin-hect

PDB Compounds: (C:) E3 ubiquitin-protein ligase NEDD4-like

SCOPe Domain Sequences for d3jw0c_:

Sequence; same for both SEQRES and ATOM records:

>d3jw0c_ d.148.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarlwiefes
ekgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsyftfig
rvaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpteldlm
fcideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnaflegftel
lpidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavllmdaek
rirllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtsfnrldlppyetf
edlrekllmavenaqg

Timeline for d3jw0c_:

• d3jw0c_ first appeared in SCOPe 2.04
  
• d3jw0c_ is called d3jw0c1 in SCOPe 2.06
  
• d3jw0c_ appears in the current release, SCOPe 2.08, called d3jw0c1