Lineage for d3jw0b_ (3jw0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939164Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2939205Domain d3jw0b_: 3jw0 B: [247065]
    Other proteins in same PDB: d3jw0c1, d3jw0c2, d3jw0d_, d3jw0x_, d3jw0y_
    automated match to d3a33a_

Details for d3jw0b_

PDB Entry: 3jw0 (more details), 3.1 Å

PDB Description: e2~ubiquitin-hect
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d3jw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jw0b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
askrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsisldilrsqwspalkiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d3jw0b_:

Click to download the PDB-style file with coordinates for d3jw0b_.
(The format of our PDB-style files is described here.)

Timeline for d3jw0b_: