Lineage for d6adha1 (6adh A:1-174,A:325-374)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109690Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 109691Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 109741Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 109742Protein Alcohol dehydrogenase [50137] (4 species)
  7. 109746Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)
  8. 109798Domain d6adha1: 6adh A:1-174,A:325-374 [24706]
    Other proteins in same PDB: d6adha2, d6adhb2

Details for d6adha1

PDB Entry: 6adh (more details), 2.9 Å

PDB Description: structure of triclinic ternary complex of horse liver alcohol dehydrogenase at 2.9 angstroms resolution

SCOP Domain Sequences for d6adha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adha1 b.35.1.2 (A:1-174,A:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d6adha1:

Click to download the PDB-style file with coordinates for d6adha1.
(The format of our PDB-style files is described here.)

Timeline for d6adha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6adha2