Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries) |
Domain d3jv4f_: 3jv4 F: [247058] Other proteins in same PDB: d3jv4a_, d3jv4c_, d3jv4e_ automated match to d1k3zb_ |
PDB Entry: 3jv4 (more details), 3.15 Å
SCOPe Domain Sequences for d3jv4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jv4f_ b.1.18.0 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkee
Timeline for d3jv4f_: