Lineage for d5adh_1 (5adh 1-174,325-374)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) Protein Alcohol dehydrogenase [50137] (4 species) Species Horse (Equus caballus) [TaxId:9796] [50138] (22 PDB entries) 
Domain d5adh_1: 5adh 1-174,325-374 [24705]
Other proteins in same PDB: d5adh_2
Details for d5adh_1
PDB Entry: 5adh (more details), 2.9 Å
PDB Description: interdomain motion in liver alcohol dehydrogenase. structural and energetic analysis of the hinge bending mode
SCOP Domain Sequences for d5adh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5adh_1 b.35.1.2 (1-174,325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf
SCOP Domain Coordinates for d5adh_1:
Click to download the PDB-style file with coordinates for d5adh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5adh_1:
- d5adh_1 appears in SCOP 1.57
- d5adh_1 appears in the current release, SCOPe 2.08, called d5adha1
View in 3D
