SCOPe 2.08: Domain d3jt0b_: 3jt0 B:

Lineage for d3jt0b_ (3jt0 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families)

5. Family b.1.16.0: automated matches [191666] (1 protein)
   not a true family

6. Protein automated matches [191265] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189832] (5 PDB entries)

8. Domain d3jt0b_: 3jt0 B: [247049]
   automated match to d1ivta_

Details for d3jt0b_

PDB Entry: 3jt0, 2.39 Å

PDB Description: crystal structure of the c-terminal fragment (426-558) lamin-b1 from homo sapiens, northeast structural genomics consortium target hr5546a

PDB Compounds: (B:) Lamin-B1

SCOPe Domain Sequences for d3jt0b_:

Sequence, based on SEQRES records:

>d3jt0b_ b.1.16.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvlkagqtvt
iwaanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvf

Sequence, based on observed residues (ATOM records):

>d3jt0b_ b.1.16.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvlkagqtvt
iwaanagvtaspptdliwknqnswgtgedvkvilknsgeevaqrstvf

Timeline for d3jt0b_:

• d3jt0b_ first appeared in SCOPe 2.04
  
• d3jt0b_ appears in SCOPe 2.07