Lineage for d3jt0a_ (3jt0 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374966Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2374983Family b.1.16.0: automated matches [191666] (1 protein)
    not a true family
  6. 2374984Protein automated matches [191265] (1 species)
    not a true protein
  7. 2374985Species Human (Homo sapiens) [TaxId:9606] [189832] (5 PDB entries)
  8. 2374992Domain d3jt0a_: 3jt0 A: [247048]
    automated match to d1ivta_

Details for d3jt0a_

PDB Entry: 3jt0 (more details), 2.39 Å

PDB Description: crystal structure of the c-terminal fragment (426-558) lamin-b1 from homo sapiens, northeast structural genomics consortium target hr5546a
PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d3jt0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jt0a_ b.1.16.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvlkagqtvti
waanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstv

SCOPe Domain Coordinates for d3jt0a_:

Click to download the PDB-style file with coordinates for d3jt0a_.
(The format of our PDB-style files is described here.)

Timeline for d3jt0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3jt0b_