Lineage for d3jr5a3 (3jr5 A:229-274)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036144Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 3036145Protein automated matches [190463] (9 species)
    not a true protein
  7. 3036175Species Geobacillus stearothermophilus [TaxId:1422] [255900] (1 PDB entry)
  8. 3036176Domain d3jr5a3: 3jr5 A:229-274 [247025]
    Other proteins in same PDB: d3jr5a1, d3jr5a2
    automated match to d1r2za3
    protein/DNA complex; complexed with gol, zn

Details for d3jr5a3

PDB Entry: 3jr5 (more details), 1.7 Å

PDB Description: mutm lesion recognition control complex with n174c crosslinking site
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3jr5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jr5a3 g.39.1.0 (A:229-274) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
qgeagtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOPe Domain Coordinates for d3jr5a3:

Click to download the PDB-style file with coordinates for d3jr5a3.
(The format of our PDB-style files is described here.)

Timeline for d3jr5a3: