![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (9 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [255900] (1 PDB entry) |
![]() | Domain d3jr5a3: 3jr5 A:229-274 [247025] Other proteins in same PDB: d3jr5a1, d3jr5a2 automated match to d1r2za3 protein/DNA complex; complexed with gol, zn |
PDB Entry: 3jr5 (more details), 1.7 Å
SCOPe Domain Sequences for d3jr5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jr5a3 g.39.1.0 (A:229-274) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} qgeagtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d3jr5a3: