Lineage for d3jr5a2 (3jr5 A:135-228)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348481Family a.156.1.0: automated matches [254300] (1 protein)
    not a true family
  6. 2348482Protein automated matches [254693] (4 species)
    not a true protein
  7. 2348483Species Geobacillus stearothermophilus [TaxId:1422] [255899] (1 PDB entry)
  8. 2348484Domain d3jr5a2: 3jr5 A:135-228 [247024]
    Other proteins in same PDB: d3jr5a1, d3jr5a3
    automated match to d1r2za1
    protein/DNA complex; complexed with gol, zn

Details for d3jr5a2

PDB Entry: 3jr5 (more details), 1.7 Å

PDB Description: mutm lesion recognition control complex with n174c crosslinking site
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3jr5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jr5a2 a.156.1.0 (A:135-228) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgciyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvrtyvnt

SCOPe Domain Coordinates for d3jr5a2:

Click to download the PDB-style file with coordinates for d3jr5a2.
(The format of our PDB-style files is described here.)

Timeline for d3jr5a2: