SCOPe 2.05: Domain d3jr5a2: 3jr5 A:135-228

Lineage for d3jr5a2 (3jr5 A:135-228)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.0: automated matches [254300] (1 protein)
   not a true family

6. Protein automated matches [254693] (3 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [255899] (1 PDB entry)

8. Domain d3jr5a2: 3jr5 A:135-228 [247024]
   Other proteins in same PDB: d3jr5a1, d3jr5a3
   automated match to d1r2za1
   protein/DNA complex; complexed with gol, zn

Details for d3jr5a2

PDB Entry: 3jr5, 1.7 Å

PDB Description: mutm lesion recognition control complex with n174c crosslinking site

PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3jr5a2:

Sequence; same for both SEQRES and ATOM records:

>d3jr5a2 a.156.1.0 (A:135-228) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgciyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvrtyvnt

Timeline for d3jr5a2:

• d3jr5a2 first appeared in SCOPe 2.04
  
• d3jr5a2 appears in SCOPe 2.06
  
• d3jr5a2 appears in the current release, SCOPe 2.08