![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.0: automated matches [254300] (1 protein) not a true family |
![]() | Protein automated matches [254693] (2 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [255899] (1 PDB entry) |
![]() | Domain d3jr5a2: 3jr5 A:135-228 [247024] Other proteins in same PDB: d3jr5a1, d3jr5a3 automated match to d1r2za1 protein/DNA complex; complexed with gol, zn |
PDB Entry: 3jr5 (more details), 1.7 Å
SCOPe Domain Sequences for d3jr5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jr5a2 a.156.1.0 (A:135-228) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldqtvvagfgciyvdeslfragilpgrpaas lsskeierlheemvatigeavmkggstvrtyvnt
Timeline for d3jr5a2: