| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.3: Small subunit [58132] (2 proteins) |
| Protein 40S subunit [254422] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry) |
| Domain d3izbu_: 3izb U: [247015] |
PDB Entry: 3izb (more details), 8.8 Å
SCOPe Domain Sequences for d3izbu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3izbu_ i.1.1.3 (U:) 40S subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdavtirtrkvisnpllarkqfvvdvlhpnranvskdelreklaevykaekdavsvfgf
rtqfgggksvgfglvynsvaeakkfeptyrlvrygl
Timeline for d3izbu_: