Lineage for d3izbs_ (3izb S:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1972283Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 1972284Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)
  7. 1972285Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry)
  8. 1972302Domain d3izbs_: 3izb S: [247013]

Details for d3izbs_

PDB Entry: 3izb (more details), 8.8 Å

PDB Description: Localization of the small subunit ribosomal proteins into a 6.1 A cryo-EM map of Saccharomyces cerevisiae translating 80S ribosome
PDB Compounds: (S:) 40S ribosomal protein rpS19 (S19e)

SCOPe Domain Sequences for d3izbs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3izbs_ i.1.1.3 (S:) Eukaryotic, cytoplasmic (40S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpgvsvrdvaaqdfinayasflqrqgklevpgyvdivktssgnemppqdaegwfykraas
varhiymrkqvgvgklnklyggaksrgvrpykhidasgsinrkvlqalekigiveispkg
grrisengqrdldriaaqtleede

SCOPe Domain Coordinates for d3izbs_:

Click to download the PDB-style file with coordinates for d3izbs_.
(The format of our PDB-style files is described here.)

Timeline for d3izbs_: