Lineage for d3izbh_ (3izb H:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711644Family i.1.1.3: Small subunit [58132] (2 proteins)
  6. 1711686Protein 40S subunit [254422] (2 species)
  7. 1711687Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry)
  8. 1711693Domain d3izbh_: 3izb H: [247002]

Details for d3izbh_

PDB Entry: 3izb (more details), 8.8 Å

PDB Description: Localization of the small subunit ribosomal proteins into a 6.1 A cryo-EM map of Saccharomyces cerevisiae translating 80S ribosome
PDB Compounds: (H:) 40S ribosomal protein rpS22 (S8p)

SCOPe Domain Sequences for d3izbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3izbh_ i.1.1.3 (H:) 40S subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtrssvladalnainnaektgkrqvlirpsskviikflqvmqkhgyigefeyiddhrsgk
ivvqlngrlnkcgvisprfnvkigdiekwtanllparqfgyvilttsagimdheearrkh
vsgkilgfvy

SCOPe Domain Coordinates for d3izbh_:

Click to download the PDB-style file with coordinates for d3izbh_.
(The format of our PDB-style files is described here.)

Timeline for d3izbh_: