Lineage for d3izbf_ (3izb F:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648718Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 2648719Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)
  7. 2648720Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry)
  8. 2648725Domain d3izbf_: 3izb F: [247001]

Details for d3izbf_

PDB Entry: 3izb (more details), 8.8 Å

PDB Description: Localization of the small subunit ribosomal proteins into a 6.1 A cryo-EM map of Saccharomyces cerevisiae translating 80S ribosome
PDB Compounds: (F:) 40S ribosomal protein rpS5 (S7p)

SCOPe Domain Sequences for d3izbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3izbf_ i.1.1.3 (F:) Eukaryotic, cytoplasmic (40S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpipeevqqaqteiklfnkwsfeevevkdaslvdyvqvrqpifvahtagryankrfrkaq
cpiierltnslmmngrnngkklkavriikhtldiinvltdqnpiqvvvdaitntgpredt
trvggggaarrqavdvsplrrvnqaialltigareaafrniktiaetlaeelinaakgss
tsyaikkkdelervaksnr

SCOPe Domain Coordinates for d3izbf_:

Click to download the PDB-style file with coordinates for d3izbf_.
(The format of our PDB-style files is described here.)

Timeline for d3izbf_: