SCOP 1.57: Domain d1adg_1: 1adg 1-174,325-374

Lineage for d1adg_1 (1adg 1-174,325-374)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)

6. Protein Alcohol dehydrogenase [50137] (4 species)

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)

8. Domain d1adg_1: 1adg 1-174,325-374 [24700]
   Other proteins in same PDB: d1adg_2

Details for d1adg_1

PDB Entry: 1adg, 2.7 Å

PDB Description: crystallographic studies of two alcohol dehydrogenase-bound analogs of thiazole-4-carboxamide adenine dinucleotide (tad), the active anabolite of the antitumor agent tiazofurin

SCOP Domain Sequences for d1adg_1:

Sequence; same for both SEQRES and ATOM records:

>d1adg_1 b.35.1.2 (1-174,325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

Timeline for d1adg_1:

• d1adg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1adg_1 appears in SCOP 1.59
  
• d1adg_1 appears in the current release, SCOPe 2.08, called d1adga1