Lineage for d3iwrb_ (3iwr B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2171120Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2171128Protein automated matches [190455] (7 species)
    not a true protein
  7. 2171140Species Oryza sativa [TaxId:39947] [255896] (1 PDB entry)
  8. 2171142Domain d3iwrb_: 3iwr B: [246995]
    automated match to d3cqla_
    complexed with mes, mpd

Details for d3iwrb_

PDB Entry: 3iwr (more details), 2.57 Å

PDB Description: crystal structure of class i chitinase from oryza sativa l. japonica
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d3iwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwrb_ d.2.1.1 (B:) automated matches {Oryza sativa [TaxId: 39947]}
psdgvgsivprdlferlllhrndgacpargfytyeaflaaaaafpafggtgntetrkrev
aaflgqtshettggwptapdgpfswgycfkqeqnppsdycqpspewpcapgrkyygrgpi
qlsfnfnygpagraigvdllsnpdlvatdatvsfktalwfwmtpqgnkpsshdvitgrwa
pspadaaagrapgygvitnivngglecghgpddrvanrigfyqrycgafgigtggnldcy
nqrpfn

SCOPe Domain Coordinates for d3iwrb_:

Click to download the PDB-style file with coordinates for d3iwrb_.
(The format of our PDB-style files is described here.)

Timeline for d3iwrb_: