SCOPe 2.06: Domain d3iwrb_: 3iwr B:

Lineage for d3iwrb_ (3iwr B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (7 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [255896] (1 PDB entry)

8. Domain d3iwrb_: 3iwr B: [246995]
   automated match to d3cqla_
   complexed with mes, mpd

Details for d3iwrb_

PDB Entry: 3iwr, 2.57 Å

PDB Description: crystal structure of class i chitinase from oryza sativa l. japonica

PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d3iwrb_:

Sequence; same for both SEQRES and ATOM records:

>d3iwrb_ d.2.1.1 (B:) automated matches {Oryza sativa [TaxId: 39947]}
psdgvgsivprdlferlllhrndgacpargfytyeaflaaaaafpafggtgntetrkrev
aaflgqtshettggwptapdgpfswgycfkqeqnppsdycqpspewpcapgrkyygrgpi
qlsfnfnygpagraigvdllsnpdlvatdatvsfktalwfwmtpqgnkpsshdvitgrwa
pspadaaagrapgygvitnivngglecghgpddrvanrigfyqrycgafgigtggnldcy
nqrpfn

Timeline for d3iwrb_:

• d3iwrb_ first appeared in SCOPe 2.04
  
• d3iwrb_ appears in SCOPe 2.05
  
• d3iwrb_ appears in SCOPe 2.07
  
• d3iwrb_ appears in the current release, SCOPe 2.08