Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.30: CutC-like [110395] (2 families) automatically mapped to Pfam PF03932 |
Family c.1.30.0: automated matches [254299] (1 protein) not a true family |
Protein automated matches [254691] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255895] (1 PDB entry) |
Domain d3iwpl_: 3iwp L: [246993] automated match to d1twdb_ |
PDB Entry: 3iwp (more details), 2.5 Å
SCOPe Domain Sequences for d3iwpl_:
Sequence, based on SEQRES records: (download)
>d3iwpl_ c.1.30.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gflmevcvdsvesavnaerggadrielcsglseggttpsmgvlqvvkqsvqipvfvmirp rggdflysdreievmkadirlaklygadglvfgaltedghidkelcmslmaicrplpvtf hrafdmvhdpmaaletlltlgfervltsgcdssaleglplikrlieqakgrivvmpgggi tdrnlqrilegsgatefhcsarstrdsgmkfrnssvamgaslscseyslkvtdvtkvrtl naiaknil
>d3iwpl_ c.1.30.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gflmevcvdsvesavnaerggadrielcsglseggttpsmgvlqvvkqsvqipvfvmirp rggdflysdreievmkadirlaklygadglvfgaltedghidkelcmslmaicrplpvtf hrafdmvhdpmaaletlltlgfervltsgcdssaleglplikrlieqakgrivvmpgggi tdrnlqrilegsgatefhcsarstrdsgmkfrnssvayslkvtdvtkvrtlnaiaknil
Timeline for d3iwpl_: