SCOP 1.75: Domain d1a72a1: 1a72 A:1-163,A:340-374

Lineage for d1a72a1 (1a72 A:1-163,A:340-374)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (36 PDB entries)
   Uniprot P00327

8. Domain d1a72a1: 1a72 A:1-163,A:340-374 [24699]
   Other proteins in same PDB: d1a72a2
   complexed with pad, zn; mutant

Details for d1a72a1

PDB Entry: 1a72, 2.6 Å

PDB Description: an active-site double mutant (phe93->trp, val203->ala) of horse liver alcohol dehydrogenase in complex with the isosteric nad analog cpad

PDB Compounds: (A:) horse liver alcohol dehydrogenase

SCOP Domain Sequences for d1a72a1:

Sequence; same for both SEQRES and ATOM records:

>d1a72a1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d1a72a1:

• d1a72a1 first appeared (with stable ids) in SCOP 1.55, called d1a72_1
  
• d1a72a1 appears in SCOP 1.73
  
• d1a72a1 appears in SCOPe 2.01
  
• d1a72a1 appears in the current release, SCOPe 2.08