Lineage for d3iwpe_ (3iwp E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090147Superfamily c.1.30: CutC-like [110395] (2 families) (S)
    automatically mapped to Pfam PF03932
  5. 2090159Family c.1.30.0: automated matches [254299] (1 protein)
    not a true family
  6. 2090160Protein automated matches [254691] (1 species)
    not a true protein
  7. 2090161Species Human (Homo sapiens) [TaxId:9606] [255895] (1 PDB entry)
  8. 2090166Domain d3iwpe_: 3iwp E: [246986]
    automated match to d1twdb_

Details for d3iwpe_

PDB Entry: 3iwp (more details), 2.5 Å

PDB Description: Crystal structure of human copper homeostasis protein CutC
PDB Compounds: (E:) Copper homeostasis protein cutC homolog

SCOPe Domain Sequences for d3iwpe_:

Sequence, based on SEQRES records: (download)

>d3iwpe_ c.1.30.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngflmevcvdsvesavnaerggadrielcsglseggttpsmgvlqvvkqsvqipvfvmir
prggdflysdreievmkadirlaklygadglvfgaltedghidkelcmslmaicrplpvt
fhrafdmvhdpmaaletlltlgfervltsgcdssaleglplikrlieqakgrivvmpggg
itdrnlqrilegsgatefhcsarstrdsgmkfrnssvamgaslscseyslkvtdvtkvrt
lnaiakni

Sequence, based on observed residues (ATOM records): (download)

>d3iwpe_ c.1.30.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngflmevcvdsvesavnaerggadrielcsglseggttpsmgvlqvvkqsvqipvfvmir
prggdflysdreievmkadirlaklygadglvfgaltedghidkelcmslmaicrplpvt
fhrafdmvhdpmaaletlltlgfervltsgcdssaleglplikrlieqakgrivvmpggg
itdrnlqrilegsgatefhcsarstrdsgmkfrnssvacseyslkvtdvtkvrtlnaiak
ni

SCOPe Domain Coordinates for d3iwpe_:

Click to download the PDB-style file with coordinates for d3iwpe_.
(The format of our PDB-style files is described here.)

Timeline for d3iwpe_: