Lineage for d3iwpa_ (3iwp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1826517Superfamily c.1.30: CutC-like [110395] (2 families) (S)
    automatically mapped to Pfam PF03932
  5. 1826529Family c.1.30.0: automated matches [254299] (1 protein)
    not a true family
  6. 1826530Protein automated matches [254691] (1 species)
    not a true protein
  7. 1826531Species Human (Homo sapiens) [TaxId:9606] [255895] (1 PDB entry)
  8. 1826532Domain d3iwpa_: 3iwp A: [246982]
    automated match to d1twdb_

Details for d3iwpa_

PDB Entry: 3iwp (more details), 2.5 Å

PDB Description: Crystal structure of human copper homeostasis protein CutC
PDB Compounds: (A:) Copper homeostasis protein cutC homolog

SCOPe Domain Sequences for d3iwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwpa_ c.1.30.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngflmevcvdsvesavnaerggadrielcsglseggttpsmgvlqvvkqsvqipvfvmir
prggdflysdreievmkadirlaklygadglvfgaltedghidkelcmslmaicrplpvt
fhrafdmvhdpmaaletlltlgfervltsgcdssaleglplikrlieqakgrivvmpggg
itdrnlqrilegsgatefhcsarstrdsgmkfrnssvamgaslscseyslkvtdvtkvrt
lnaiaknil

SCOPe Domain Coordinates for d3iwpa_:

Click to download the PDB-style file with coordinates for d3iwpa_.
(The format of our PDB-style files is described here.)

Timeline for d3iwpa_: