SCOP 1.63: Domain d1ldyd1: 1ldy D:1-174,D:325-374

Lineage for d1ldyd1 (1ldy D:1-174,D:325-374)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (6 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (5 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (30 PDB entries)

8. Domain d1ldyd1: 1ldy D:1-174,D:325-374 [24698]
   Other proteins in same PDB: d1ldya2, d1ldyb2, d1ldyc2, d1ldyd2
   complexed with cxf, nad, zn

Details for d1ldyd1

PDB Entry: 1ldy, 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)

SCOP Domain Sequences for d1ldyd1:

Sequence; same for both SEQRES and ATOM records:

>d1ldyd1 b.35.1.2 (D:1-174,D:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

Timeline for d1ldyd1:

• d1ldyd1 first appeared (with stable ids) in SCOP 1.55
  
• d1ldyd1 appears in SCOP 1.61
  
• d1ldyd1 appears in SCOP 1.65
  
• d1ldyd1 appears in the current release, SCOPe 2.08