Lineage for d1ldyd1 (1ldy D:1-174,D:325-374)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58601Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 58602Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 58652Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 58653Protein Alcohol dehydrogenase [50137] (4 species)
  7. 58657Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)
  8. 58703Domain d1ldyd1: 1ldy D:1-174,D:325-374 [24698]
    Other proteins in same PDB: d1ldya2, d1ldyb2, d1ldyc2, d1ldyd2

Details for d1ldyd1

PDB Entry: 1ldy (more details), 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)

SCOP Domain Sequences for d1ldyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldyd1 b.35.1.2 (D:1-174,D:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d1ldyd1:

Click to download the PDB-style file with coordinates for d1ldyd1.
(The format of our PDB-style files is described here.)

Timeline for d1ldyd1: