Lineage for d1ldyd1 (1ldy D:1-174,D:325-374)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) Protein Alcohol dehydrogenase [50137] (4 species) Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries) 
Domain d1ldyd1: 1ldy D:1-174,D:325-374 [24698]
Other proteins in same PDB: d1ldya2, d1ldyb2, d1ldyc2, d1ldyd2
Details for d1ldyd1
PDB Entry: 1ldy (more details), 2.5 Å
PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)
SCOP Domain Sequences for d1ldyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldyd1 b.35.1.2 (D:1-174,D:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf
SCOP Domain Coordinates for d1ldyd1:
Click to download the PDB-style file with coordinates for d1ldyd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ldyd1:
View in 3D
