Lineage for d3ivya_ (3ivy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005739Species Mycobacterium tuberculosis [TaxId:83332] [226004] (12 PDB entries)
  8. 2005747Domain d3ivya_: 3ivy A: [246978]
    automated match to d2xc3a_
    complexed with hem

Details for d3ivya_

PDB Entry: 3ivy (more details), 1.35 Å

PDB Description: crystal structure of mycobacterium tuberculosis cytochrome p450 cyp125, p212121 crystal form
PDB Compounds: (A:) Cytochrome P450 CYP125

SCOPe Domain Sequences for d3ivya_:

Sequence, based on SEQRES records: (download)

>d3ivya_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdggfwaitklndv
keisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrkiisrgftpra
vgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqedrgklfhwsne
mtgnedpeyahidpkassaeligyamkmaeekaknpaddivtqliqadidgeklsddefg
ffvvmlavagnettrnsitqgmmafaehpdqwelykkvrpetaadeivrwatpvtafqrt
alrdyelsgvqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgfggtgahycig
anlarmtinlifnavadhmpdlkpisaperlrsgwlngikhwqvdytg

Sequence, based on observed residues (ATOM records): (download)

>d3ivya_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdggfwaitklndv
keisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrkiisrgftpra
vgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqedrgklfhwsne
mtgnedpeyahidpkassaeligyamkmaeekivtqliqadgeklsddefgffvvmlava
gnettrnsitqgmmafaehpdqwelykkvrpetaadeivrwatpvtafqrtalrdyelsg
vqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgfggtgahyciganlarmtin
lifnavadhmpdlkpisaperlrsgwlngikhwqvdytg

SCOPe Domain Coordinates for d3ivya_:

Click to download the PDB-style file with coordinates for d3ivya_.
(The format of our PDB-style files is described here.)

Timeline for d3ivya_: