![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Aeromonas punctata [TaxId:648] [232631] (8 PDB entries) |
![]() | Domain d3ivma2: 3ivm A:418-688 [246977] Other proteins in same PDB: d3ivma1 automated match to d3iula2 complexed with zpr |
PDB Entry: 3ivm (more details), 2.05 Å
SCOPe Domain Sequences for d3ivma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ivma2 c.69.1.0 (A:418-688) automated matches {Aeromonas punctata [TaxId: 648]} edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnagh gagtpvaklieqsadiyaftlyemgyrelpr
Timeline for d3ivma2: