Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) |
Family b.69.7.0: automated matches [227149] (1 protein) not a true family |
Protein automated matches [226853] (3 species) not a true protein |
Species Aeromonas punctata [TaxId:648] [232629] (8 PDB entries) |
Domain d3ivma1: 3ivm A:7-417 [246976] Other proteins in same PDB: d3ivma2 automated match to d3iula1 complexed with zpr |
PDB Entry: 3ivm (more details), 2.05 Å
SCOPe Domain Sequences for d3ivma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ivma1 b.69.7.0 (A:7-417) automated matches {Aeromonas punctata [TaxId: 648]} lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik eklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff yssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvteddrfll isaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvt vdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpg lgsvsgfngkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkp
Timeline for d3ivma1: