Lineage for d3iuma1 (3ium A:7-417)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066340Family b.69.7.0: automated matches [227149] (1 protein)
    not a true family
  6. 2066341Protein automated matches [226853] (3 species)
    not a true protein
  7. 2066342Species Aeromonas punctata [TaxId:648] [232629] (8 PDB entries)
  8. 2066349Domain d3iuma1: 3ium A:7-417 [246968]
    Other proteins in same PDB: d3iuma2
    automated match to d3iula1
    complexed with gol

Details for d3iuma1

PDB Entry: 3ium (more details), 2.25 Å

PDB Description: apPEP_WTX opened state
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3iuma1:

Sequence, based on SEQRES records: (download)

>d3iuma1 b.69.7.0 (A:7-417) automated matches {Aeromonas punctata [TaxId: 648]}
lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
eklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
yssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvteddrfll
isaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvt
vdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpg
lgsvsgfngkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkp

Sequence, based on observed residues (ATOM records): (download)

>d3iuma1 b.69.7.0 (A:7-417) automated matches {Aeromonas punctata [TaxId: 648]}
lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
eklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
yssydkptdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvteddrfllisaansts
gnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvtvdaanpgp
ahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpglgsvsgfn
gkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkp

SCOPe Domain Coordinates for d3iuma1:

Click to download the PDB-style file with coordinates for d3iuma1.
(The format of our PDB-style files is described here.)

Timeline for d3iuma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iuma2