Lineage for d3itbc2 (3itb C:259-352)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820866Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2820867Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2820897Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 2820898Protein automated matches [231758] (5 species)
    not a true protein
  7. 2820899Species Escherichia coli [TaxId:562] [232620] (4 PDB entries)
  8. 2820902Domain d3itbc2: 3itb C:259-352 [246963]
    Other proteins in same PDB: d3itba1, d3itbb1, d3itbc1, d3itbd1
    automated match to d3it9a2
    complexed with so4

Details for d3itbc2

PDB Entry: 3itb (more details), 1.8 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in complex with a substrate fragment
PDB Compounds: (C:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3itbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3itbc2 b.105.1.0 (C:259-352) automated matches {Escherichia coli [TaxId: 562]}
fetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlkasytltepqltap
lkkgqvvgtidfqlngksieqrplivmenveegg

SCOPe Domain Coordinates for d3itbc2:

Click to download the PDB-style file with coordinates for d3itbc2.
(The format of our PDB-style files is described here.)

Timeline for d3itbc2: