SCOPe 2.06: Domain d3itbc1: 3itb C:6-258

Lineage for d3itbc1 (3itb C:6-258)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)

8. Domain d3itbc1: 3itb C:6-258 [246962]
   Other proteins in same PDB: d3itba2, d3itbb2, d3itbc2, d3itbd2
   automated match to d3it9a1
   complexed with so4, suc

Details for d3itbc1

PDB Entry: 3itb, 1.8 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in complex with a substrate fragment

PDB Compounds: (C:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3itbc1:

Sequence; same for both SEQRES and ATOM records:

>d3itbc1 e.3.1.0 (C:6-258) automated matches {Escherichia coli [TaxId: 562]}
veapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdmv
tvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqesf
iglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekeft
fnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrirf
neseklltwgfrf

Timeline for d3itbc1:

• d3itbc1 first appeared in SCOPe 2.04
  
• d3itbc1 appears in SCOPe 2.05
  
• d3itbc1 appears in SCOPe 2.07
  
• d3itbc1 appears in the current release, SCOPe 2.08