Lineage for d3itbb2 (3itb B:259-352)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811682Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 1811683Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 1811713Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 1811714Protein automated matches [231758] (2 species)
    not a true protein
  7. 1811715Species Escherichia coli [TaxId:562] [232620] (3 PDB entries)
  8. 1811717Domain d3itbb2: 3itb B:259-352 [246961]
    Other proteins in same PDB: d3itba1, d3itbb1, d3itbc1, d3itbd1
    automated match to d3it9a2
    complexed with so4, suc

Details for d3itbb2

PDB Entry: 3itb (more details), 1.8 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in complex with a substrate fragment
PDB Compounds: (B:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3itbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3itbb2 b.105.1.0 (B:259-352) automated matches {Escherichia coli [TaxId: 562]}
fetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlkasytltepqltap
lkkgqvvgtidfqlngksieqrplivmenveegg

SCOPe Domain Coordinates for d3itbb2:

Click to download the PDB-style file with coordinates for d3itbb2.
(The format of our PDB-style files is described here.)

Timeline for d3itbb2: