Lineage for d1axgd1 (1axg D:1-163,D:340-374)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2055999Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2056016Species Horse (Equus caballus) [TaxId:9796] [50138] (46 PDB entries)
    Uniprot P00327
  8. 2056101Domain d1axgd1: 1axg D:1-163,D:340-374 [24694]
    Other proteins in same PDB: d1axga2, d1axgb2, d1axgc2, d1axgd2
    complexed with etf, nad, zn; mutant

Details for d1axgd1

PDB Entry: 1axg (more details), 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution
PDB Compounds: (D:) alcohol dehydrogenase

SCOPe Domain Sequences for d1axgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axgd1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1axgd1:

Click to download the PDB-style file with coordinates for d1axgd1.
(The format of our PDB-style files is described here.)

Timeline for d1axgd1: