SCOP 1.71: Domain d1axgd1: 1axg D:1-163,D:340-374

Lineage for d1axgd1 (1axg D:1-163,D:340-374)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (34 PDB entries)

8. Domain d1axgd1: 1axg D:1-163,D:340-374 [24694]
   Other proteins in same PDB: d1axga2, d1axgb2, d1axgc2, d1axgd2
   complexed with etf, nad, zn; mutant

Details for d1axgd1

PDB Entry: 1axg, 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution

SCOP Domain Sequences for d1axgd1:

Sequence; same for both SEQRES and ATOM records:

>d1axgd1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d1axgd1:

• d1axgd1 first appeared (with stable ids) in SCOP 1.55
  
• d1axgd1 appears in SCOP 1.69
  
• d1axgd1 appears in SCOP 1.73
  
• d1axgd1 appears in the current release, SCOPe 2.08