SCOPe 2.08: Domain d3im6a_: 3im6 A:

Lineage for d3im6a_ (3im6 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.6: MIR domain [82109] (3 families)

5. Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 proteins)
   Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5

6. Protein automated matches [254610] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255499] (9 PDB entries)

8. Domain d3im6a_: 3im6 A: [246932]
   automated match to d3hsma_
   complexed with so4; mutant

Details for d3im6a_

PDB Entry: 3im6, 1.7 Å

PDB Description: crystal structure of mouse ryanodine receptor 2 mutant v186m

PDB Compounds: (A:) Cardiac Ca2+ release channel

SCOPe Domain Sequences for d3im6a_:

Sequence, based on SEQRES records:

>d3im6a_ b.42.6.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qflrtddevvlqctatihkeqqklclaaegfgnrlcflestsnsknvppdlsictfvleq
slsvralqemlantveksegqvdvekwkfmmktaqggghrtllyghaillrhsysgmylc
clstsrsstdklafdvglqedttgeacwwtihpaskqrsegekvrvgddlilvsmssery
lhlsygnsswhvdaafqqtlwsvapi

Sequence, based on observed residues (ATOM records):

>d3im6a_ b.42.6.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qflrtddevvlqctatihkeqqklclaaegfgnrlcflestsvppdlsictfvleqslsv
ralqemlantvewhrtllyghaillrhsysgmylcclstslafdvglqedttgeacwwti
hpaskqrsegekvrvgddlilvsmsserylhlsygnsswhvdaafqqtlwsvapi

Timeline for d3im6a_:

• d3im6a_ first appeared in SCOPe 2.04
  
• d3im6a_ appears in SCOPe 2.07