SCOPe 2.04: Domain d3im5b_: 3im5 B:

Lineage for d3im5b_ (3im5 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.6: MIR domain [82109] (3 families)

5. Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 proteins)
   Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5

6. Protein automated matches [254610] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255499] (9 PDB entries)

8. Domain d3im5b_: 3im5 B: [246931]
   automated match to d3hsma_

Details for d3im5b_

PDB Entry: 3im5, 2.55 Å

PDB Description: Crystal structure of mouse Ryanodine Receptor 2 (residues 1-217)

PDB Compounds: (B:) Cardiac Ca2+ release channel

SCOPe Domain Sequences for d3im5b_:

Sequence, based on SEQRES records:

>d3im5b_ b.42.6.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qflrtddevvlqctatihkeqqklclaaegfgnrlcflestsnsknvppdlsictfvleq
slsvralqemlantveksegqvdvekwkfmmktaqggghrtllyghaillrhsysgmylc
clstsrsstdklafdvglqedttgeacwwtihpaskqrsegekvrvgddlilvsvssery
lhlsygnsswhvdaafqqtlwsvapi

Sequence, based on observed residues (ATOM records):

>d3im5b_ b.42.6.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qflrtddevvlqctatieqqklclaaegfgnrlcflestsnsknvppdlsictfvleqsl
svralqemlantvwhrtllyghaillrhsysgmylcclstslafdvglqedttgeacwwt
ihpaskqrsegekvrvgddlilvsvsserylhlsygnsswhvdaafqqtlwsvapi

Timeline for d3im5b_:

• d3im5b_ is new in SCOPe 2.04-stable
  
• d3im5b_ appears in SCOPe 2.05
  
• d3im5b_ appears in the current release, SCOPe 2.08