SCOPe 2.08: Domain d3iklb1: 3ikl B:368-485

Lineage for d3iklb1 (3ikl B:368-485)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142419] (2 PDB entries)
   Uniprot Q9UHN1 369-485

8. Domain d3iklb1: 3ikl B:368-485 [246921]
   automated match to d1g5hd1

Details for d3iklb1

PDB Entry: 3ikl, 3.1 Å

PDB Description: crystal structure of pol gb delta-i4.

PDB Compounds: (B:) DNA polymerase subunit gamma-2, mitochondrial

SCOPe Domain Sequences for d3iklb1:

Sequence; same for both SEQRES and ATOM records:

>d3iklb1 c.51.1.1 (B:368-485) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hrkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletmqssleq
lyskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyissaknv

Timeline for d3iklb1:

• d3iklb1 first appeared in SCOPe 2.04
  
• d3iklb1 appears in SCOPe 2.07