Lineage for d1axgb1 (1axg B:1-163,B:340-374)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2395084Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2395105Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2395122Species Horse (Equus caballus) [TaxId:9796] [50138] (52 PDB entries)
    Uniprot P00327
  8. 2395216Domain d1axgb1: 1axg B:1-163,B:340-374 [24692]
    Other proteins in same PDB: d1axga2, d1axgb2, d1axgc2, d1axgd2
    complexed with etf, nad, zn; mutant

Details for d1axgb1

PDB Entry: 1axg (more details), 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1axgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axgb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1axgb1:

Click to download the PDB-style file with coordinates for d1axgb1.
(The format of our PDB-style files is described here.)

Timeline for d1axgb1: